Radhe Krishna Shayari HD Wallpaper icon

Radhe Krishna Shayari HD Wallpaper

CA 1.0.1 for Android
3.9 | 10,000+ Instalacje

Chalisa Sangrah

Opis Radhe Krishna Shayari HD Wallpaper

Radhe Krishna Shayari HD Wallpaper || राधे कृष्णा -हिंदी शायरी
राधा-कृष्ण के प्रेम को पूरी दुनिया जानती हैं राधा-कृष्ण की प्रेम कहानी अपने आप में प्रेम की परिभाषा हैं हमने इस एप्प में राधा कृष्णा के प्रेम को दिखाया है। राधे कृष्णा हिंदी शायरी में आपको मिलेंगी राधा कृष्ण की फोटोज पर सूंदर शायरी। आप इन शायरी को आसानी शेयर भी कर सकतें हैं।
- Silent Features of Radhe Krishna Shayari HD Wallpaper app.
☀️ Share: Share your status with your friends and family members via Whatssup, Email, SMS and other available sharing options on your device.
☀️ Professionally designed, user-friendly and intuitive interface.
☀️ Simple app. No internet connection needed!
◙Disclaimer:
1. This app is a self-contained offline app with a part of the contents from public domain.
2. The purpose of app is to provide entertainment/general information to user. All the images and text contained in the app are collected from different internet sources. All the images are readily available in various places on the internet and are believed to be in the public domain. However, we do not claim ownership/copyright of material/media used in the app. We acknowledge that the respective copyright owners of the contents own the rights. If you own the right to any content in the app, please write to us at [email protected] with the copyright details of the original source. No infringement intended.

Informacja

  • Kategoria:
    Społeczności
  • Aktualna wersja:
    CA 1.0.1
  • Zaktualizowano:
    2019-11-07
  • Rozmiar:
    10.4MB
  • Wymaga Androida:
    Android 4.0.3 or later
  • Deweloper:
    Chalisa Sangrah
  • ID:
    com.chalisaapps.radhekrishanwallpapershayari